Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 498 (Olfr498)

This Recombinant Mouse Olfactory receptor 498 (Olfr498) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

Olfactory receptor 498, Olfactory receptor 204-36

UniProt

Q8VEW2

Expression Region

1-330

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFLEDGNHTTVTEFILLGLTDDPVLRDILFIIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFILSHLASVDIGISSSVTPNMLATFLVKQNTISYIGCSIQFTSAAFFGTVECFLLAT MAYDRFVAICNPLLYSTKMSTEACIQLVVGSYIQGFLNASFFTLSFFSLFFCGPNRINDF YCDFAPLLELSCSDVTVAVVITSISAGFITLTTVFVIAISYSCIFITIMKMHSTESRCKA FSTCTSHLTAVILFYGTAIFIYVMPKSSYSTDQNKVLSIFYTVVIPMLNPLIYSLRNNEI KEALKRHLGKKVFSYGNLFCKTHYNHNYPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-THRAP3 antibody
PAab08673 100 µg

Anti-THRAP3 antibody

Sign In for Pricing
View Details
Rat cholest erolester transfer protein, CETP ELISA Kit
SL0161Ra-01 48 Tests

Rat cholest erolester transfer protein, CETP ELISA Kit

Sign In for Pricing
View Details
Rat cholest erolester transfer protein, CETP ELISA Kit
SL0161Ra-02 96 Tests

Rat cholest erolester transfer protein, CETP ELISA Kit

Sign In for Pricing
View Details
Porcine Hexokinase 1 ELISA Kit
MBS031529-01 48 Well

Porcine Hexokinase 1 ELISA Kit

Sign In for Pricing
View Details
Porcine Hexokinase 1 ELISA Kit
MBS031529-02 96 Well

Porcine Hexokinase 1 ELISA Kit

Sign In for Pricing
View Details
Porcine Hexokinase 1 ELISA Kit
MBS031529-03 5x 96 Well

Porcine Hexokinase 1 ELISA Kit

Sign In for Pricing
View Details