Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 3 (Gpr3)

This Recombinant Mouse G-protein coupled receptor 3 (Gpr3) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

G-protein coupled receptor 3, GPCR21

UniProt

P35413

Expression Region

1-330

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMWGAGSSMAWFSAGSGSVNVSSVDPVEEPTGPATLLPSPRAWDVVLCISGTLVSCENAL VVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAADFCIGSPEMSLMLVGVLAMAF TASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWVGALGLGLVPVLAWNCRDG LTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYV ATRKGIATLAVVLGAFAACWLPFTVYCLLGDADSPRLYTYLTLLPATYNSMINPVIYAFR NQDVQKVLWAICCCCSTSKIPFRSRSPSDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dicyclohexylamine N- ((benzyloxy) carbonyl) -O- (tert-butyl) -D-threoninate
OR1063151-01 1 g

Dicyclohexylamine N- ((benzyloxy) carbonyl) -O- (tert-butyl) -D-threoninate

Sign In for Pricing
View Details
Dicyclohexylamine N- ((benzyloxy) carbonyl) -O- (tert-butyl) -D-threoninate
OR1063151-02 5 g

Dicyclohexylamine N- ((benzyloxy) carbonyl) -O- (tert-butyl) -D-threoninate

Sign In for Pricing
View Details
Dicyclohexylamine N- ((benzyloxy) carbonyl) -O- (tert-butyl) -D-threoninate
OR1063151-03 25 g

Dicyclohexylamine N- ((benzyloxy) carbonyl) -O- (tert-butyl) -D-threoninate

Sign In for Pricing
View Details
Beta Catenin Rabbit Monoclonal Antibody
E10G22693 100 µL

Beta Catenin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-SAP97/DLG1 Antibody Picoband® Fluoro647 Conjugated
PB9552-Fluoro647 100 µg/Vial

Anti-SAP97/DLG1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
GLC1L Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV726695 1.0 µg DNA

GLC1L Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details