Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 3 (Gpr3)

This Recombinant Mouse G-protein coupled receptor 3 (Gpr3) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

G-protein coupled receptor 3, GPCR21

UniProt

P35413

Expression Region

1-330

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMWGAGSSMAWFSAGSGSVNVSSVDPVEEPTGPATLLPSPRAWDVVLCISGTLVSCENAL VVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAADFCIGSPEMSLMLVGVLAMAF TASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWVGALGLGLVPVLAWNCRDG LTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYV ATRKGIATLAVVLGAFAACWLPFTVYCLLGDADSPRLYTYLTLLPATYNSMINPVIYAFR NQDVQKVLWAICCCCSTSKIPFRSRSPSDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endothelin 1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-42253R-BF594 100 µL

Endothelin 1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Anti-CD147 antibody (2D2), IgG1 Chimeric mAb
E33C101093 100 µL

Anti-CD147 antibody (2D2), IgG1 Chimeric mAb

Sign In for Pricing
View Details
SULT1C4
enz-710 5µg

SULT1C4

Sign In for Pricing
View Details
Anti-RANK/Tnfrsf11a Picoband® Antibody, Dylight550 Conjugate
A01064-3-Dylight550 100 µg

Anti-RANK/Tnfrsf11a Picoband® Antibody, Dylight550 Conjugate

Sign In for Pricing
View Details
SNX7 Protein Lysate (Rat) with C-HA Tag
45088036 100 µg

SNX7 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Lentiviral mouse Glrp1 shRNA (UAS) - Lentiviral mouse Glrp1 shRNA (UAS, RFP) (100)
GTR15198600 1 Vial

Lentiviral mouse Glrp1 shRNA (UAS) - Lentiviral mouse Glrp1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details