Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 3 (Gpr3)

This Recombinant Mouse G-protein coupled receptor 3 (Gpr3) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

G-protein coupled receptor 3, GPCR21

UniProt

P35413

Expression Region

1-330

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMWGAGSSMAWFSAGSGSVNVSSVDPVEEPTGPATLLPSPRAWDVVLCISGTLVSCENAL VVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAADFCIGSPEMSLMLVGVLAMAF TASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWVGALGLGLVPVLAWNCRDG LTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYV ATRKGIATLAVVLGAFAACWLPFTVYCLLGDADSPRLYTYLTLLPATYNSMINPVIYAFR NQDVQKVLWAICCCCSTSKIPFRSRSPSDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MAPRE2 Antibody
A06859 100 µL

Anti-MAPRE2 Antibody

Sign In for Pricing
View Details
Human Cytochrome C (Cyt-C) ELISA Kit
MBS266489-01 48 Well

Human Cytochrome C (Cyt-C) ELISA Kit

Sign In for Pricing
View Details
Human Cytochrome C (Cyt-C) ELISA Kit
MBS266489-02 96 Well

Human Cytochrome C (Cyt-C) ELISA Kit

Sign In for Pricing
View Details
Human Cytochrome C (Cyt-C) ELISA Kit
MBS266489-03 5x 96 Well

Human Cytochrome C (Cyt-C) ELISA Kit

Sign In for Pricing
View Details
Human Cytochrome C (Cyt-C) ELISA Kit
MBS266489-04 10x 96 Well

Human Cytochrome C (Cyt-C) ELISA Kit

Sign In for Pricing
View Details
HERC2 3'UTR Lenti-reporter-Luc Vector
23194081 1.0 µg

HERC2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details