Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aspergillus oryzae Chitin synthase export chaperone (chs7)

This Recombinant Aspergillus oryzae Chitin synthase export chaperone (chs7) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

Chitin synthase export chaperone

UniProt

Q2UNJ0

Expression Region

1-331

Origin

Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFGDFDTICQKAALPLCSLVGPASSISGATGIIPNCYARNIELANTIIFEGAASFVHII ALAMTVIMILHIRSKFTAVGRKEIITFFYIYMLLTMCSLVIDAGVVPPRSGPFPYFVAVQ NGLTSALCTSLLVNGFVGFQLYEDGTALSVWLLRLTSTAMFAISFVISLLTFKSWGGLSP TNTVGMFVVLYILNAICIAVYLIMQLLLVMNTLEDRWPLGHIAFGLLVFICGQVLLYAFS DTICENVQHYLDGLFFTTICNLLAVMMVYKFWDYITKEDLEFSVGIKPNTWEVKEFLPEE DRRATVYQDTNSEYAGSMYHHRASAYNNHNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERO1A antibody
FNab02852 100 µg

ERO1A antibody

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR562108 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
FOXA1 / HNF3A (FOXA1/2230R), CF488A conjugate, 0.1mg/mL
BNC882230-500 1x 500 µL

FOXA1 / HNF3A (FOXA1/2230R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Azido-PEG1-amine
TRC-A965463-10MG 10 mg

Azido-PEG1-amine

Sign In for Pricing
View Details
Mouse Troponin T Type 1, Slow Skeletal (TNNT1) ELISA Kit
RDR-TNNT1-Mu-01 96 Tests

Mouse Troponin T Type 1, Slow Skeletal (TNNT1) ELISA Kit

Sign In for Pricing
View Details
Mouse Troponin T Type 1, Slow Skeletal (TNNT1) ELISA Kit
RDR-TNNT1-Mu-02 48 Tests

Mouse Troponin T Type 1, Slow Skeletal (TNNT1) ELISA Kit

Sign In for Pricing
View Details