Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Taste receptor type 2 member 38 (T2r38)

This Recombinant Rat Taste receptor type 2 member 38 (T2r38) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 38, T2R38, Taste receptor type 2 member 26, T2R26

UniProt

Q4VHE7

Expression Region

1-331

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLTLTPVLTVSYEAKISFLFLSVVEFAVGIMANAFIVLVNFWDMVKKQPLNNCDIALLCL SITRLFLQGLLLLDAIQLACFQQMKDPLSHNYQAILTLWMSANQVSLWLAACLSLLYCAK IVRFSHTFPLHLASWVSRRFLQMLLVALLFSGVCTALCLWDFFSRSHTVVTSMLHMNNTE FNLQIEKLNFFYSFVFCNVGSVPPSLVFLISSGVLVISLGNHMRTMKSQTRGSRDPSLEA HVRAIIFLVSFLCFYVVSFCAALISIPLLVLWHNKGGVMVCIGMMAACPSGHAAILISGN AKLKKVIVTILFWFQSRQKVRRVHKVLPRIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
BNC401045-100 1x 100 µL

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-500 1x 500 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
BNC550633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-100 1x 100 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (KRT18/2819R), CF640R conjugate, 0.1mg/mL
BNC402819-100 1x 100 µL

Cytokeratin 18 (KRT18) (KRT18/2819R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (h-CALD), CF640R conjugate, 0.1mg/mL
BNC400819-100 1x 100 µL

Caldesmon, HMW (h-Caldesmon) (h-CALD), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details