Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 867 (Olfr867)

This Recombinant Mouse Olfactory receptor 867 (Olfr867) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

Olfactory receptor 867

UniProt

Q7TRF3

Expression Region

1-331

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIENHTLITKFLILGLSDDPELQPILFGLFLSMYLVTLLGNLLIILAVSSDSHLHKPMY FLLSNLSFIDICFISTTIPKMLVNMQSQIKDISYIECLTQVFFFNIFAGMDNFLLTLMAY DRFVAICHPLNYTVIMNPRLCALLILMFWIIMFWVSLIHVLLMNELNFSRGTEIPHFFCE LAQVLKVSNSDNHVNNVFMYVVTSLLGVIPMTGILMSYSQIFSSLFRMSSTVSKYKAFST CGSHLCVVTLFYGSGFGVYFSSSVVHSTQRRKVASLMYTVISPMLNPFIYTLRNKDVKGA LGKLFNRVASSPSCINDIRNKLLLRSVRQIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Pentraxin 3 / PTX3 Recombinant Rabbit monoclonal Antibody
HA723390 100 µL

Human Pentraxin 3 / PTX3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
N-Nitroso Spirapril
TRC-S682530-5MG 5 mg

N-Nitroso Spirapril

Sign In for Pricing
View Details
Human KRTAP19-4 activation kit by CRISPRa
GA117351 1 Kit

Human KRTAP19-4 activation kit by CRISPRa

Sign In for Pricing
View Details
N acetylglucosamine kinase (NAGK) Mouse Monoclonal Antibody [Clone ID: AT4D12]
AM50019PU-N 100 µL

N acetylglucosamine kinase (NAGK) Mouse Monoclonal Antibody [Clone ID: AT4D12]

Sign In for Pricing
View Details
GPR73B (PROKR2) (NM_144773) Human Recombinant Protein
TP311216M 100 µg

GPR73B (PROKR2) (NM_144773) Human Recombinant Protein

Sign In for Pricing
View Details
Human PLCZ1 activation kit by CRISPRa
GA113946 1 Kit

Human PLCZ1 activation kit by CRISPRa

Sign In for Pricing
View Details