Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 867 (Olfr867)

This Recombinant Mouse Olfactory receptor 867 (Olfr867) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

Olfactory receptor 867

UniProt

Q7TRF3

Expression Region

1-331

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIENHTLITKFLILGLSDDPELQPILFGLFLSMYLVTLLGNLLIILAVSSDSHLHKPMY FLLSNLSFIDICFISTTIPKMLVNMQSQIKDISYIECLTQVFFFNIFAGMDNFLLTLMAY DRFVAICHPLNYTVIMNPRLCALLILMFWIIMFWVSLIHVLLMNELNFSRGTEIPHFFCE LAQVLKVSNSDNHVNNVFMYVVTSLLGVIPMTGILMSYSQIFSSLFRMSSTVSKYKAFST CGSHLCVVTLFYGSGFGVYFSSSVVHSTQRRKVASLMYTVISPMLNPFIYTLRNKDVKGA LGKLFNRVASSPSCINDIRNKLLLRSVRQIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cixutumumab Biosimilar - Research Grade
ICH5144-20mg 20 mg

Cixutumumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS631630 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
(1S,2R,4S,5R,6S)-3,8-Dioxatricyclo[3.2.1.02,4]octane-6-carboxylic Acid Ethyl Ester
TRC-D485920-25MG 25 mg

(1S,2R,4S,5R,6S)-3,8-Dioxatricyclo[3.2.1.02,4]octane-6-carboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
NKIRAS1 (NM_020345) Human Recombinant Protein
TP304248L 1 mg

NKIRAS1 (NM_020345) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant TOE1 Antibody
RC-16543-01 50 μL

Recombinant TOE1 Antibody

Sign In for Pricing
View Details
Recombinant TOE1 Antibody
RC-16543-02 100 µL

Recombinant TOE1 Antibody

Sign In for Pricing
View Details