Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Proteinase-activated receptor 3 (F2rl2)

This Recombinant Rat Proteinase-activated receptor 3 (F2rl2) spans the amino acid sequence from region 38-368.

Product Specifications

Product Name Alternative

Proteinase-activated receptor 3, PAR-3, Coagulation factor II receptor-like 2, Thrombin receptor-like 2

UniProt

Q920E1

Expression Region

38-368

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SFNGNEHSFEEFPLSDIEGWTGATTTIKAKCPEESITTLHVNNATMGYLRSSLSTKVIPA IYILVFVIGVPANIVTLWKLSSRTKSICLVIFHTNLAIADLLFCVTLPFKIAYHLNGNDW VFGEVMCRVTTVAFYGNMYCAILILTCMGINRYLATVHPFTYRKLPKRNFTLLMCGVVWV MVVLYMLPLAILKQEYHLVQPGITTCHDVHDTCESPLPFQFYYFVSLAFFGFLIPFVVSV FCYTTLIHKLNAQDRKWLRYIKAVLLILVIFTICFAPTNIILIIHHANYYYSNTDSLYFM YLIALCLGSLNSCLDPFLYFIMSKIVDQLTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF640R conjugate, 0.1mg/mL
BNC400160-100 1x 100 µL

CD20 (B9E9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-500 1x 500 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-100 1x 100 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL
BNC040149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-100 1x 100 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL
BNC941050-100 1x 100 µL

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details