Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6K3 (OR6K3)

This Recombinant Human Olfactory receptor 6K3 (OR6K3) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

Olfactory receptor 6K3, Olfactory receptor OR1-18

UniProt

Q8NGY3

Expression Region

1-331

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCWTMPSPFTGSSTRNMESGNQSTVTEFIFTGFPQLQDGSLLYFFPLLFIYTFIIIDNLL IFSAVRLDTHLHNPMYNFISIFSFLEIWYTTATIPKMLSNLISEKKAISMTGCILQMYFF HSLENSEGILLTTMAIDRYVAICNPLRYQMIMTPRLCAQLSAGSCLFGFLILLPEIVMIS TLPFCGPNQIHQIFCDLVPVLSLACTDTSMILIEDVIHAVTIIITFLIIALSYVRIVTVI LRIPSSEGRQKAFSTCAGHLMVFPIFFGSVSLMYLRFSDTYPPVLDTAIALMFTVLAPFF NPIIYSLRNKDMNNAIKKLFCLQKVLNKPGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GOLGA8S activation kit by CRISPRa
GA118817 1 Kit

Human GOLGA8S activation kit by CRISPRa

Sign In for Pricing
View Details
Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker), CF405S conjugate, 0.1mg/mL
BNC041645-100 1x 100 µL

Glypican-3 (GPC3) (Hepatocellular Carcinoma Marker), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TFPI2 Human Gene Knockout Kit (CRISPR)
KN202760RB 1 Kit

TFPI2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) (N-Terminal) (rPTH/911), 0.2mg/mL
BNUB1899-100 1x 100 µL

Parathyroid Hormone (PTH) (N-Terminal) (rPTH/911), 0.2mg/mL

Sign In for Pricing
View Details
XRCC1 Rabbit Monoclonal Antibody [Clone ID: R02-0B0]
TA421660 100 µL

XRCC1 Rabbit Monoclonal Antibody [Clone ID: R02-0B0]

Sign In for Pricing
View Details
Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody [Clone ID: ODC-22]
AM20652PU-N 100 µg

Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody [Clone ID: ODC-22]

Sign In for Pricing
View Details