Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6K3 (OR6K3)

This Recombinant Human Olfactory receptor 6K3 (OR6K3) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

Olfactory receptor 6K3, Olfactory receptor OR1-18

UniProt

Q8NGY3

Expression Region

1-331

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCWTMPSPFTGSSTRNMESGNQSTVTEFIFTGFPQLQDGSLLYFFPLLFIYTFIIIDNLL IFSAVRLDTHLHNPMYNFISIFSFLEIWYTTATIPKMLSNLISEKKAISMTGCILQMYFF HSLENSEGILLTTMAIDRYVAICNPLRYQMIMTPRLCAQLSAGSCLFGFLILLPEIVMIS TLPFCGPNQIHQIFCDLVPVLSLACTDTSMILIEDVIHAVTIIITFLIIALSYVRIVTVI LRIPSSEGRQKAFSTCAGHLMVFPIFFGSVSLMYLRFSDTYPPVLDTAIALMFTVLAPFF NPIIYSLRNKDMNNAIKKLFCLQKVLNKPGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cpt1a activation kit by CRISPRa
GA200859 1 Kit

Mouse Cpt1a activation kit by CRISPRa

Sign In for Pricing
View Details
Rb (RB1) pSer788 Rabbit Polyclonal Antibody
AP12698PU-N 400 µL

Rb (RB1) pSer788 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant RhoGAP Antibody
RC-16243-01 50 μL

Recombinant RhoGAP Antibody

Sign In for Pricing
View Details
Recombinant RhoGAP Antibody
RC-16243-02 100 µL

Recombinant RhoGAP Antibody

Sign In for Pricing
View Details
Recombinant RhoGAP Antibody
RC-16243-03 1 mL

Recombinant RhoGAP Antibody

Sign In for Pricing
View Details
(1R,2R)-(-)-2-Amino-1-phenyl-1,3-propanediol
TRC-A636763-250MG 250 mg

(1R,2R)-(-)-2-Amino-1-phenyl-1,3-propanediol

Sign In for Pricing
View Details