Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat N-arachidonyl glycine receptor (Gpr18)

This Recombinant Rat N-arachidonyl glycine receptor (Gpr18) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

N-arachidonyl glycine receptor, NAGly receptor, G-protein coupled receptor 18

UniProt

A1A5S3

Expression Region

1-331

Origin

Rattus norvegicus (Rat)

Field of Research

Pharmacology & Drug Discovery; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAIPSNRDQLALSNGSHPEEYKIAALVFYSCIFLIGLLVNVTALWVFSCTTKKRTTVTIY MMNVALLDLVFILSLPFRMFYYAKGEWPFGDYFCHILGALVVFYPSLALWLLALISADRY MAIVQPKYAKELKNTGKAVLACVGVWIMTLTTTVPLLLLDEDPDKASSPATCLKISDIIH LKAVNVLNFTRLIFFFLIPLFIMIGCYVVIIHSLLRGQTSKLKPKVKEKSIRIIVTLLLQ VLACFVPFHICFALLMLQGEENSYSPWGAFTTFLMNLSTCLDVVLYYIVSKQFQARVISV MLYRNYLRSVRRKSVRSGSLRSLSNMNSEML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
BNC740633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
BNC681429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL
BNC041429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
BNC680633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
BNC040034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details