Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor 1174 (Olr1174)

This Recombinant Rat Olfactory receptor 1174 (Olr1174) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

Olfactory receptor 1174, Putative gustatory receptor PTE33

UniProt

P35896

Expression Region

1-331

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKMENHTLISEFFLLDLSDDPKLQPFLFGLFLSMYLVTMLGNLLIILAVSSNSQLHNPMY FFLSNLSFVDICFISTTVPKMLVNMQSQTKDISYIECLTQVYFFNTFVGMDDVLLTLMAY DCFVAICNPLKYTIIMNPRVCTLLVLMFWIIMFCISLIHVLLMNELNFSRGTKIPHFFCE LAQVLKVSNSDTHINNIFMYVLSSLLGVIPMTGILMSYSQIVSSLLRMSSTVSKYKAFST CGSHLCVVCLFYGSVIGVYFSSSVVLSTQRIMVASLMYTVISPMLNPFIYSLRNKDVKVA LGELFIRVAPCPSWINDIITKFILKNIRQNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCDC191 activation kit by CRISPRa
GA111604 1 Kit

Human CCDC191 activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD8a Antibody[YTS 105.18]
AN00331L-01 50 Tests

Elab Fluor® 488 Anti-Mouse CD8a Antibody[YTS 105.18]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD8a Antibody[YTS 105.18]
AN00331L-02 100 Tests

Elab Fluor® 488 Anti-Mouse CD8a Antibody[YTS 105.18]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD8a Antibody[YTS 105.18]
AN00331L-03 2x 100 Tests

Elab Fluor® 488 Anti-Mouse CD8a Antibody[YTS 105.18]

Sign In for Pricing
View Details
GP2 (Glycoprotein 2) / ZAP75 (GP2/3416), CF740 conjugate, 0.1mg/mL
BNC743416-500 1x 500 µL

GP2 (Glycoprotein 2) / ZAP75 (GP2/3416), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PRH1 activation kit by CRISPRa
GA103750 1 Kit

Human PRH1 activation kit by CRISPRa

Sign In for Pricing
View Details