Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Olfactory receptor 1174 (Olr1174)

This Recombinant Rat Olfactory receptor 1174 (Olr1174) spans the amino acid sequence from region 1-331.

Product Specifications

Product Name Alternative

Olfactory receptor 1174, Putative gustatory receptor PTE33

UniProt

P35896

Expression Region

1-331

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKMENHTLISEFFLLDLSDDPKLQPFLFGLFLSMYLVTMLGNLLIILAVSSNSQLHNPMY FFLSNLSFVDICFISTTVPKMLVNMQSQTKDISYIECLTQVYFFNTFVGMDDVLLTLMAY DCFVAICNPLKYTIIMNPRVCTLLVLMFWIIMFCISLIHVLLMNELNFSRGTKIPHFFCE LAQVLKVSNSDTHINNIFMYVLSSLLGVIPMTGILMSYSQIVSSLLRMSSTVSKYKAFST CGSHLCVVCLFYGSVIGVYFSSSVVLSTQRIMVASLMYTVISPMLNPFIYSLRNKDVKVA LGELFIRVAPCPSWINDIITKFILKNIRQNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Evaporation Loss Tester BPTL-206
BPTL-206 1 Unit

Evaporation Loss Tester BPTL-206

Sign In for Pricing
View Details
Digital Display Ultrasonic Cleaner BULC-301
BULC-301 Each

Digital Display Ultrasonic Cleaner BULC-301

Sign In for Pricing
View Details
Phospho-Cdk2 (Y15) Recombinant Rabbit monoclonal Antibody
HA750260 100 µL

Phospho-Cdk2 (Y15) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
SBK3 Human Gene Knockout Kit (CRISPR)
KN433871 1 Kit

SBK3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GPR89C Human Gene Knockout Kit (CRISPR)
KN416530 1 Kit

GPR89C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cathepsin L (CTSL) Mouse Monoclonal Antibody [Clone ID: OTI6B8]
CF809364 100 µg

Cathepsin L (CTSL) Mouse Monoclonal Antibody [Clone ID: OTI6B8]

Sign In for Pricing
View Details