Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vulpes vulpes Melanocortin receptor 4 (MC4R)

This Recombinant Vulpes vulpes Melanocortin receptor 4 (MC4R) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

Melanocortin receptor 4, MC4-R

UniProt

Q0Z8I9

Expression Region

1-332

Origin

Vulpes vulpes (Red fox)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTLQHGMHTSLHFWNRSTYGQHSNATESLGKGYPDGGCYEQLFVSPEVFVTLGVISLL ENILVIVAIAKNKNLHSPMYFFICSLAVADMLVSVSNGSETIVITLLNSTDTDAQSFTVN IDNVIDSVICSSLLASICSLLSIAVDRYFTIFYALQYHNIMTVRRVGIIISCIWAACTVS GILFIIYSDSTAVIICLITMFFTMLALMASLYVHMFLMARLHIKRIAVLPGTGTIRQGAN MKGAITLTILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSIIDPL IYALRSQELRKTFKEIICCYPLGGLCDLSSRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF594 conjugate, 0.1mg/mL
BNC940305-100 1x 100 µL

CD95 (B-R18), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF488A conjugate, 0.1mg/mL
BNC880322-500 1x 500 µL

CD3e (RIV9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (HJ21), CF640R conjugate, 0.1mg/mL
BNC400984-100 1x 100 µL

P21 / WAF1 (HJ21), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
BNC040009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adiponectin (Marker of Obesity) (ADPN/1370), CF740 conjugate, 0.1mg/mL
BNC741370-100 1x 100 µL

Adiponectin (Marker of Obesity) (ADPN/1370), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF640R conjugate, 0.1mg/mL
BNC402416-100 1x 100 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details