Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phaeosphaeria nodorum Chitin synthase export chaperone (CHS7)

This Recombinant Phaeosphaeria nodorum Chitin synthase export chaperone (CHS7) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

Chitin synthase export chaperone

UniProt

Q0UDX8

Expression Region

1-332

Origin

Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Septoria nodorum)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFGDFSTICTKAAIPLCALVGEQQINGGAGIQTNCYSRTIEIANTLIFQCANDFMHILA MVMTVIMIIHVRSKFTAVGRKEITSVFYIYLLLTIISLILDAGVTAPGSAPYPYFAAVQN GLVSALCTCLLINGFVGFQLYEDGTTLSVWLLRLCSLAMFVVSGAVSLLTFKNWAGLSSK NPIGIMIVTYIVNAIFLFVYVVSQIILVVGTLEDRWPLGDISFGVFFFVIGQVILYVFSD TICDNVQHYIDGLFFATICNLLAVMMVYKYWDSITREDLEFSVGVKQHNWEVKELLPDED KRGTVYQDSDYTPSLYQQQYNGRHSHYSNLGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOS1 (1418-1434) Rabbit Polyclonal Antibody
AP23248PU-N 100 µg

NOS1 (1418-1434) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bsx Mouse Gene Knockout Kit (CRISPR)
KN502290 1 Kit

Bsx Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
UBR7 Antibody
KC-2182-01 50 μL

UBR7 Antibody

Sign In for Pricing
View Details
UBR7 Antibody
KC-2182-02 100 µL

UBR7 Antibody

Sign In for Pricing
View Details
UBR7 Antibody
KC-2182-03 1 mL

UBR7 Antibody

Sign In for Pricing
View Details
PSMD7 Recombinant Rabbit monoclonal Antibody
HA750757 100 µL

PSMD7 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details