Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chaetomium globosum Chitin synthase export chaperone (CHS7)

This Recombinant Chaetomium globosum Chitin synthase export chaperone (CHS7) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

Chitin synthase export chaperone

UniProt

Q2H7Q1

Expression Region

1-332

Origin

Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) (Soil fungus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFGDFTGLCRMAPLPLCSSVGPITSIASGVGIEPDCYARNIEVANTIIFQGAASAMHII ALVMTVVMILHVRGKFTAVGRKEITTFFYLYMLLTFLSLCVDAGVVPPGSAPYPYFVAVQ AGLASATVTCLMINGFVGFQLYEDGTPLSLWMMRLCSAAAFVISFLVALATFKTWAGLGP TNTIGLFVVLYLLNAVQLFVYVVLQVLLVMRTLHDRWPLGDIAFGMFFFVAGQVILYAAS APICKAISHYLDGLFFATTCNLLAVMMVYKYWDSITKEDLEFSVGTRMNNWEVKDLLPEE DRRATVYHDDPYGQSTAYDNSYSPSPNRHSRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Fallopian tube
CS617393 5x 5 µm

Frozen Tissue Sections, Fallopian tube

Sign In for Pricing
View Details
Rabbit Monoclonal IL-13R alpha 1 Antibody (26) [Alexa Fluor 350]
NBP2-89716AF350 0.1 mL

Rabbit Monoclonal IL-13R alpha 1 Antibody (26) [Alexa Fluor 350]

Sign In for Pricing
View Details
P2Y8 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb1576830 100 µL

P2Y8 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Myelin Protein Zero (MPZ) (NM_000530) Human Tagged Lenti ORF Clone
RC202450L2 10 µg

Myelin Protein Zero (MPZ) (NM_000530) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Katanin p80 Antibody
orb1322586 100 µL

Katanin p80 Antibody

Sign In for Pricing
View Details
CD8A antibody
70R-9676 100 µL

CD8A antibody

Sign In for Pricing
View Details