Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chaetomium globosum Chitin synthase export chaperone (CHS7)

This Recombinant Chaetomium globosum Chitin synthase export chaperone (CHS7) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

Chitin synthase export chaperone

UniProt

Q2H7Q1

Expression Region

1-332

Origin

Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) (Soil fungus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGFGDFTGLCRMAPLPLCSSVGPITSIASGVGIEPDCYARNIEVANTIIFQGAASAMHII ALVMTVVMILHVRGKFTAVGRKEITTFFYLYMLLTFLSLCVDAGVVPPGSAPYPYFVAVQ AGLASATVTCLMINGFVGFQLYEDGTPLSLWMMRLCSAAAFVISFLVALATFKTWAGLGP TNTIGLFVVLYLLNAVQLFVYVVLQVLLVMRTLHDRWPLGDIAFGMFFFVAGQVILYAAS APICKAISHYLDGLFFATTCNLLAVMMVYKYWDSITKEDLEFSVGTRMNNWEVKDLLPEE DRRATVYHDDPYGQSTAYDNSYSPSPNRHSRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr498 ORF Vector (Mouse) (pORF)
33204014 1.0 µg DNA

Olfr498 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
GCSF Receptor Polyclonal Antibody, HRP Conjugated
bs-2574R-HRP-TR 20 µL

GCSF Receptor Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Laboratory Low Speed Centrifuge (BFS-206)
BFS-206 1 Unit

Laboratory Low Speed Centrifuge (BFS-206)

Sign In for Pricing
View Details
DKK4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV647079 1.0 µg DNA

DKK4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Maize Starch
LA1080 100 g

Maize Starch

Sign In for Pricing
View Details
STK11 Antibody
GWB-MV449H 50 µg

STK11 Antibody

Sign In for Pricing
View Details