Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Adenosine receptor A2b (Adora2b)

This Recombinant Mouse Adenosine receptor A2b (Adora2b) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

Adenosine receptor A2b

UniProt

Q60614

Expression Region

1-332

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFA IPFAITISLGFCTDFHGCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGT RARGIIAVLWVLAFGIGLTPFLGWNSKDSATSNCTELGDGIANKSCCPVTCLFENVVPMS YMVYFNFFGCVLPPLLIMLVIYIKIFMVACKQLQRMELMDHSRTTLQREIHAAKSLAMIV GIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYS FHKIISRYVLCQAETKGGSGQAGAQSTLSLGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Anti-Mouse Lambda-HRP
MBS673053-01 1 mL

Rat Anti-Mouse Lambda-HRP

Sign In for Pricing
View Details
Rat Anti-Mouse Lambda-HRP
MBS673053-02 5x 1 mL

Rat Anti-Mouse Lambda-HRP

Sign In for Pricing
View Details
Zymo-Spin™ IB Columns (50 Pack) (Uncapped)
C1014-50 50 PCS

Zymo-Spin™ IB Columns (50 Pack) (Uncapped)

Sign In for Pricing
View Details
Rabbit Anti-Human BCoR Polyclonal Antibody
PA85684HU-01 50 µg

Rabbit Anti-Human BCoR Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human BCoR Polyclonal Antibody
PA85684HU-02 100 µg

Rabbit Anti-Human BCoR Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human BCoR Polyclonal Antibody
PA85684HU-03 500 µg

Rabbit Anti-Human BCoR Polyclonal Antibody

Sign In for Pricing
View Details