Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-10 (sra-10)

This Recombinant Serpentine receptor class alpha-10 (sra-10) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-10, Protein sra-10

UniProt

Q60T32

Expression Region

1-332

Origin

Caenorhabditis briggsae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSSNISICATEDQMVLQTSLLLRVNVILMTTVAIFTFVLTYRALFILKQRPIFHKSTKI LLYTSLIFVNIHEIIFMVIQCVAFIRSFTLSDKPCEIMRTTLECRFKNHVLIFGIAGMNF NQFGLTVDRLLATVIPQTYSHLGSFPGILISILVIGCSIAAPLIIAIGDPYDDIVPNCFF FPQHSAPRANVFLIILSALVIASIFLNLIIIFANKKLEKGTRYYVSQRYQKREALISTRI IVYIAASQFLGMVLYSTIVLTLRLHKSMIPVSMYHNIVWWAYTVPFAAVALPALLIHRIN LVGSNRKRVINRITAKVETQEEHMKSLKELWG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Corticotropin) BioAssayTM ELISA Kit discontinued
519109 96 Tests

ACTH (Corticotropin) BioAssayTM ELISA Kit discontinued

Sign In for Pricing
View Details
Mouse Gm8091 Pre-designed siRNA Set B
SI105588B 1 Each

Mouse Gm8091 Pre-designed siRNA Set B

Sign In for Pricing
View Details
MTR (NM_000254) Human Tagged Lenti ORF Clone
RC214275L4 10 µg

MTR (NM_000254) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
RPS12P32 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV783130 1.0 µg DNA

RPS12P32 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Recombinant Vascular Endothelial Growth Factor Receptor 1 (VEGFR1)
MBS2009783-01 0.01 mg

Recombinant Vascular Endothelial Growth Factor Receptor 1 (VEGFR1)

Sign In for Pricing
View Details
Recombinant Vascular Endothelial Growth Factor Receptor 1 (VEGFR1)
MBS2009783-02 0.05 mg

Recombinant Vascular Endothelial Growth Factor Receptor 1 (VEGFR1)

Sign In for Pricing
View Details