Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-10 (sra-10)

This Recombinant Serpentine receptor class alpha-10 (sra-10) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-10, Protein sra-10

UniProt

Q60T32

Expression Region

1-332

Origin

Caenorhabditis briggsae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSSNISICATEDQMVLQTSLLLRVNVILMTTVAIFTFVLTYRALFILKQRPIFHKSTKI LLYTSLIFVNIHEIIFMVIQCVAFIRSFTLSDKPCEIMRTTLECRFKNHVLIFGIAGMNF NQFGLTVDRLLATVIPQTYSHLGSFPGILISILVIGCSIAAPLIIAIGDPYDDIVPNCFF FPQHSAPRANVFLIILSALVIASIFLNLIIIFANKKLEKGTRYYVSQRYQKREALISTRI IVYIAASQFLGMVLYSTIVLTLRLHKSMIPVSMYHNIVWWAYTVPFAAVALPALLIHRIN LVGSNRKRVINRITAKVETQEEHMKSLKELWG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti Bovine Catalase
NE029/7S 10 mg

Rabbit anti Bovine Catalase

Sign In for Pricing
View Details
Mouse Pth1r qPCR Primer Pair
QM19578S 200 Tests

Mouse Pth1r qPCR Primer Pair

Sign In for Pricing
View Details
ZNF266 Peptide
MBS3227747-01 0.1 mg

ZNF266 Peptide

Sign In for Pricing
View Details
ZNF266 Peptide
MBS3227747-02 5x 0.1 mg

ZNF266 Peptide

Sign In for Pricing
View Details
Polyclonal Antibody to CLEC4E
11-4050-100 100 µg

Polyclonal Antibody to CLEC4E

Sign In for Pricing
View Details
PLG siRNA (Rat)
MBS8200982-01 15 nmol

PLG siRNA (Rat)

Sign In for Pricing
View Details