Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Adenosine receptor A2b (ADORA2B)

This Recombinant Dog Adenosine receptor A2b (ADORA2B) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

Adenosine receptor A2b

UniProt

Q6W3F4

Expression Region

1-332

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQLETQDALYVALELAIAALSVAGNVLVCAAVGTSSALQTPTNYFLVSLAAADVAVGLFA IPFAITISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKSLVTGT RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNCTEPWDGTTNESCCLVKCLFENVVPMSY MVYFNFFGCVLPPLLIMLVIYIKIFMVACKQLQRTELVDHSRTVIQREIHAAKSLAMIVG IFALCWLPVHAINCVTLFQPARAKDKPKWAMNMAILLSHASSVVNPIVYAYRNRDFRYTF HKIISRYVLCQTDVLKSGNGQAGTQSALDVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiotensin I/II (5-8)
C03719-100mg 100 mg

Angiotensin I/II (5-8)

Sign In for Pricing
View Details
Rabbit Polyclonal FAM12A Antibody
NBP2-13945-25ul 25 µL

Rabbit Polyclonal FAM12A Antibody

Sign In for Pricing
View Details
Human Probable DNA dC->dU-editing enzyme APOBEC-3A (APOBEC3A) ELISA Kit
NSL1201Hu 96 Tests

Human Probable DNA dC->dU-editing enzyme APOBEC-3A (APOBEC3A) ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Histone H2B (AcK16) Antibody
MBS4513718-01 0.05 mL

Rabbit anti-Histone H2B (AcK16) Antibody

Sign In for Pricing
View Details
Rabbit anti-Histone H2B (AcK16) Antibody
MBS4513718-02 0.1 mL

Rabbit anti-Histone H2B (AcK16) Antibody

Sign In for Pricing
View Details
Rabbit anti-Histone H2B (AcK16) Antibody
MBS4513718-03 5x 0.1 mL

Rabbit anti-Histone H2B (AcK16) Antibody

Sign In for Pricing
View Details