Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus subsp. pastoris Protoheme IX farnesyltransferase (ctaB)

This Recombinant Prochlorococcus marinus subsp. pastoris Protoheme IX farnesyltransferase (ctaB) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

Protoheme IX farnesyltransferase, EC= 2.5.1.-, Heme B farnesyltransferase, Heme O synthase

UniProt

Q7V2M7

Expression Region

1-332

Origin

Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSNLENLNFQTSIREQVVPSRKKVKLPAWLEVAKPRLIPLLLATTLGGMALTEEWPLSS PKLICTLGGGALAAAAAGALNCLWEMDLDKRMKRTSDRALPSGKLSFNTVFLGAVSCTLA AAMLLISGVNYLAAGLTLLGLCSYVILYTIILKPRTTQNIVFGGVAGAIPPLVGASAATG HVGLSGWWLFSLVMLWTPAHFWALAILLKDDYASVGIPMLPSVKGSEFTVKAISRYGWAT VFMSILGVFALPEGGILYLIMLLPFNGRLLQLINRLKSSPDDLEKAKGLFRWSILYMFGI CLLLLISRTQLSVDFEHQSMQMFLSLKAYFNY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
BNC880181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL
BNC740003-500 1x 500 µL

CD45RO (UCHL-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
BNC941081-500 1x 500 µL

CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF594 conjugate, 0.1mg/mL
BNC940645-100 1x 100 µL

FOXP3 (3G3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-100 1x 100 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
BNC470806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details