Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Adenosine receptor A2b (ADORA2B)

This Recombinant Human Adenosine receptor A2b (ADORA2B) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

Adenosine receptor A2b

UniProt

P29275

Expression Region

1-332

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT FHKIISRYLLCQADVKSGNGQAGVQPALGVGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Stomach
CS707978 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
CNTF Human Gene Knockout Kit (CRISPR)
KN422331 1 Kit

CNTF Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TBC1D25 Human Gene Knockout Kit (CRISPR)
KN421238 1 Kit

TBC1D25 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MEX3C Human Gene Knockout Kit (CRISPR)
KN421125 1 Kit

MEX3C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), CF640R conjugate, 0.1mg/mL
BNC401897-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tgfbi Mouse Gene Knockout Kit (CRISPR)
KN517486 1 Kit

Tgfbi Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details