Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proteinase-activated receptor 3 (F2rl2)

This Recombinant Mouse Proteinase-activated receptor 3 (F2rl2) spans the amino acid sequence from region 38-369.

Product Specifications

Product Name Alternative

Proteinase-activated receptor 3, PAR-3, Coagulation factor II receptor-like 2, Thrombin receptor-like 2

UniProt

O08675

Expression Region

38-369

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SFNGGPQNTFEEFPLSDIEGWTGATTTIKAECPEDSISTLHVNNATIGYLRSSLSTQVIP AIYILLFVVGVPANIVTLWKLSLRTKSISLVIFHTNLAIADLLFCVTLPFKIAYHLNGNN WVFGEVTCRITTVVFYGNMYCAILILTCMGINRYLATAHPFTYQKLPKRSFSMLMCGMVW VMVFLYMLPFVILKQEYHLVHSEITTCHDVVDACESPSSFRFYYFVSLAFFGFLIPFVII IFCYTTLIHKLKSKDRIWLGYIKAVLLILVIFTICFAPTNIILVIHHANYYYHNTDSLYF MYLIALCLGSLNSCLDPFLYFVMSKVVDQLNP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human POLR1A activation kit by CRISPRa
GA108605 1 Kit

Human POLR1A activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Cecum
CS644005 5x 5 µm

Frozen Tissue Sections, Cecum

Sign In for Pricing
View Details
AAV2 Rabbit Monoclonal Antibody [Clone ID: OTIR1C1]
TA594213 100 µL

AAV2 Rabbit Monoclonal Antibody [Clone ID: OTIR1C1]

Sign In for Pricing
View Details
DMT1 (SLC11A2) (NM_001174130) Human Over-expression Lysate
LC433268 20 µg

DMT1 (SLC11A2) (NM_001174130) Human Over-expression Lysate

Sign In for Pricing
View Details
Human MPP8 (MPHOSPH8) activation kit by CRISPRa
GA110234 1 Kit

Human MPP8 (MPHOSPH8) activation kit by CRISPRa

Sign In for Pricing
View Details
ICAM2 Mouse Monoclonal Antibody [Clone ID: B-T1]
AM31349FC-N 1 mL (100 Tests)

ICAM2 Mouse Monoclonal Antibody [Clone ID: B-T1]

Sign In for Pricing
View Details