Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Proteinase-activated receptor 3 (F2rl2)

This Recombinant Mouse Proteinase-activated receptor 3 (F2rl2) spans the amino acid sequence from region 38-369.

Product Specifications

Product Name Alternative

Proteinase-activated receptor 3, PAR-3, Coagulation factor II receptor-like 2, Thrombin receptor-like 2

UniProt

O08675

Expression Region

38-369

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SFNGGPQNTFEEFPLSDIEGWTGATTTIKAECPEDSISTLHVNNATIGYLRSSLSTQVIP AIYILLFVVGVPANIVTLWKLSLRTKSISLVIFHTNLAIADLLFCVTLPFKIAYHLNGNN WVFGEVTCRITTVVFYGNMYCAILILTCMGINRYLATAHPFTYQKLPKRSFSMLMCGMVW VMVFLYMLPFVILKQEYHLVHSEITTCHDVVDACESPSSFRFYYFVSLAFFGFLIPFVII IFCYTTLIHKLKSKDRIWLGYIKAVLLILVIFTICFAPTNIILVIHHANYYYHNTDSLYF MYLIALCLGSLNSCLDPFLYFVMSKVVDQLNP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-AcmNPV Envelope glycoprotein gp64/AcmNPV-gp64 Neutralizing Antibody
E-AB-V1051-01 200 µL

Anti-AcmNPV Envelope glycoprotein gp64/AcmNPV-gp64 Neutralizing Antibody

Sign In for Pricing
View Details
Anti-AcmNPV Envelope glycoprotein gp64/AcmNPV-gp64 Neutralizing Antibody
E-AB-V1051-02 500 µL

Anti-AcmNPV Envelope glycoprotein gp64/AcmNPV-gp64 Neutralizing Antibody

Sign In for Pricing
View Details
MASP2 (NC_006610) Human Over-expression Lysate
LY434597 100 µg

MASP2 (NC_006610) Human Over-expression Lysate

Sign In for Pricing
View Details
CD44 Mouse Monoclonal Antibody [Clone ID: OX-49]
CL110P 250 µg

CD44 Mouse Monoclonal Antibody [Clone ID: OX-49]

Sign In for Pricing
View Details
ZAP70 Mouse Monoclonal Antibody [A1B7]
EM1902-28 100 µL

ZAP70 Mouse Monoclonal Antibody [A1B7]

Sign In for Pricing
View Details
Eph receptor A3 (EPHA3) (C-term) Rabbit Polyclonal Antibody
AP14277PU-N 400 µL

Eph receptor A3 (EPHA3) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details