Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Adenosine receptor A2b (Adora2b)

This Recombinant Rat Adenosine receptor A2b (Adora2b) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

Adenosine receptor A2b

UniProt

P29276

Expression Region

1-332

Origin

Rattus norvegicus (Rat)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFA IPFAITISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGT RARGIIAVLWVLAFGIGLTPFLGWNSKDRATSNCTEPGDGITNKSCCPVKCLFENVVPMS YMVYFNFFGCVLPPLLIMMVIYIKIFMVACKQLQHMELMEHSRTTLQREIHAAKSLAMIV GIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYS FHRIISRYVLCQTDTKGGSGQAGGQSTFSLSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Atrial natriuretic peptide receptor 3 ELISA Kit
MBS753043-01 48 Well

Canine Atrial natriuretic peptide receptor 3 ELISA Kit

Sign In for Pricing
View Details
Canine Atrial natriuretic peptide receptor 3 ELISA Kit
MBS753043-02 96 Well

Canine Atrial natriuretic peptide receptor 3 ELISA Kit

Sign In for Pricing
View Details
Canine Atrial natriuretic peptide receptor 3 ELISA Kit
MBS753043-03 5x 96 Well

Canine Atrial natriuretic peptide receptor 3 ELISA Kit

Sign In for Pricing
View Details
Canine Atrial natriuretic peptide receptor 3 ELISA Kit
MBS753043-04 10x 96 Well

Canine Atrial natriuretic peptide receptor 3 ELISA Kit

Sign In for Pricing
View Details
MOV10 (B-3) AC
sc-515722 AC 500 µg/mL - 25% ag

MOV10 (B-3) AC

Sign In for Pricing
View Details
Recombinant Mouse T-cell ecto-ADP-ribosyltransferase 1 (Art2a)
MBS1225151-01 0.02 mg (E-Coli)

Recombinant Mouse T-cell ecto-ADP-ribosyltransferase 1 (Art2a)

Sign In for Pricing
View Details