Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Adenosine receptor A2b (Adora2b)

This Recombinant Rat Adenosine receptor A2b (Adora2b) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

Adenosine receptor A2b

UniProt

P29276

Expression Region

1-332

Origin

Rattus norvegicus (Rat)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFA IPFAITISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGT RARGIIAVLWVLAFGIGLTPFLGWNSKDRATSNCTEPGDGITNKSCCPVKCLFENVVPMS YMVYFNFFGCVLPPLLIMMVIYIKIFMVACKQLQHMELMEHSRTTLQREIHAAKSLAMIV GIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYS FHRIISRYVLCQTDTKGGSGQAGGQSTFSLSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KMT2B siRNA (Mouse)
MBS8221477-01 15 nmol

KMT2B siRNA (Mouse)

Sign In for Pricing
View Details
KMT2B siRNA (Mouse)
MBS8221477-02 30 nmol

KMT2B siRNA (Mouse)

Sign In for Pricing
View Details
KMT2B siRNA (Mouse)
MBS8221477-03 5x 30 nmol

KMT2B siRNA (Mouse)

Sign In for Pricing
View Details
Anti-CLDN16 antibody
STJ111904 100 µl

Anti-CLDN16 antibody

Sign In for Pricing
View Details
Compound NP-023822
MBS5793253 Inquire

Compound NP-023822

Sign In for Pricing
View Details
Mouse Monoclonal ILT2/CD85j/LILRB1 Antibody (VMP55) [CoraFluor 1]
NBP2-50475CL1 0.1 mL

Mouse Monoclonal ILT2/CD85j/LILRB1 Antibody (VMP55) [CoraFluor 1]

Sign In for Pricing
View Details