Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable G-protein coupled receptor 33 (GPR33)

This Recombinant Human Probable G-protein coupled receptor 33 (GPR33) spans the amino acid sequence from region 1-333.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 33

UniProt

Q49SQ1

Expression Region

1-333

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLINSTDYLINASTLVRNSTQFLAPASKMIIALSLYISSIIGTITNGLYLWVLRFKMKQ TVNTLLFFHLILSYFISTMILPFMATSQLQDNHWNFGTALCKVFNGTLSLGMFTSVFFLS AIGLDRYLLTLHPVWSQQHRTPRWASSIVLGVWISAAALSIPYLIFRETHHDRKGKVTCQ NNYAVSTNWESKEMQASRQWIHVACFISRFLLGFLLPFFIIIFCYERVASKVKERSLFKS SKPFKVMMTAIISFFVCWMPYHIHQGLLLTTNQSLLLELTLILTVLTTSFNTIFSPTLYL FVGENFKKVFKKSILALFESTFSEDSSVERTQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SEC62 shRNA (UAS) - Lentiviral human SEC62 shRNA (UAS, RFP) (100)
GTR15334383 1 Vial

Lentiviral human SEC62 shRNA (UAS) - Lentiviral human SEC62 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Parathyroid Hormone (PTH)
MBS344074-01 0.1 mL (Concentrate)

Parathyroid Hormone (PTH)

Sign In for Pricing
View Details
Parathyroid Hormone (PTH)
MBS344074-02 7 mL (RTU)

Parathyroid Hormone (PTH)

Sign In for Pricing
View Details
Parathyroid Hormone (PTH)
MBS344074-03 1 mL (Concentrate)

Parathyroid Hormone (PTH)

Sign In for Pricing
View Details
Parathyroid Hormone (PTH)
MBS344074-04 5x 7 mL (RTU)

Parathyroid Hormone (PTH)

Sign In for Pricing
View Details
Parathyroid Hormone (PTH)
MBS344074-05 5x 1 mL (Concentrate)

Parathyroid Hormone (PTH)

Sign In for Pricing
View Details