Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable G-protein coupled receptor 33 (GPR33)

This Recombinant Human Probable G-protein coupled receptor 33 (GPR33) spans the amino acid sequence from region 1-333.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 33

UniProt

Q49SQ1

Expression Region

1-333

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLINSTDYLINASTLVRNSTQFLAPASKMIIALSLYISSIIGTITNGLYLWVLRFKMKQ TVNTLLFFHLILSYFISTMILPFMATSQLQDNHWNFGTALCKVFNGTLSLGMFTSVFFLS AIGLDRYLLTLHPVWSQQHRTPRWASSIVLGVWISAAALSIPYLIFRETHHDRKGKVTCQ NNYAVSTNWESKEMQASRQWIHVACFISRFLLGFLLPFFIIIFCYERVASKVKERSLFKS SKPFKVMMTAIISFFVCWMPYHIHQGLLLTTNQSLLLELTLILTVLTTSFNTIFSPTLYL FVGENFKKVFKKSILALFESTFSEDSSVERTQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMB6, Mouse (His)
HY-P75989 1 Each

PSMB6, Mouse (His)

Sign In for Pricing
View Details
Zinc Finger Protein With KRAB And SCAN Domains 2 (ZKSCAN2) Antibody
abx307690-01 20 µg

Zinc Finger Protein With KRAB And SCAN Domains 2 (ZKSCAN2) Antibody

Sign In for Pricing
View Details
Zinc Finger Protein With KRAB And SCAN Domains 2 (ZKSCAN2) Antibody
abx307690-02 50 µg

Zinc Finger Protein With KRAB And SCAN Domains 2 (ZKSCAN2) Antibody

Sign In for Pricing
View Details
Zinc Finger Protein With KRAB And SCAN Domains 2 (ZKSCAN2) Antibody
abx307690-03 100 µg

Zinc Finger Protein With KRAB And SCAN Domains 2 (ZKSCAN2) Antibody

Sign In for Pricing
View Details
Zinc Finger Protein With KRAB And SCAN Domains 2 (ZKSCAN2) Antibody
abx307690-04 200 µg

Zinc Finger Protein With KRAB And SCAN Domains 2 (ZKSCAN2) Antibody

Sign In for Pricing
View Details
Zinc Finger Protein With KRAB And SCAN Domains 2 (ZKSCAN2) Antibody
abx307690-05 1 mg

Zinc Finger Protein With KRAB And SCAN Domains 2 (ZKSCAN2) Antibody

Sign In for Pricing
View Details