Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 12 (Olfr12)

This Recombinant Mouse Olfactory receptor 12 (Olfr12) spans the amino acid sequence from region 1-333.

Product Specifications

Product Name Alternative

Olfactory receptor 12, Odorant receptor M76

UniProt

Q60894

Expression Region

1-333

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATAVHRNGSLTPVSLRVFVLVGFGGGALTQALLFAVFLVLYVVTVLGNLTMIVVITLDA RLHSPMYFFLKNLSFVDLCYSSAIAPNALANFLSTSKVISFEACATQFFFFSLLATTETF LLAVMAYDRFMAICSPLRYPVTMCPTTCTRLVLGTFCVGCLNSIVQTSLTFQLPFCSSNR IDHFYCDVPPLLQLACASTALNELFLFGLCGFIIVSTTLAVLVSYGYITVTILRMHSGSG RHKVFSTCGSHLTAVSLFYGTLFVMYAQPGALTSMEQGKVVSIFYTLVIPMLNPLIYSLR NKDVKDALQRLGQRHSLVKAVRGCPAAGGNASV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL27 Protein Vector (Human) (pPB-C-His)
PV035905 500 ng

RPL27 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
TBC1D3 siRNA (Human)
CRJ8745-01 15 nmol

TBC1D3 siRNA (Human)

Sign In for Pricing
View Details
TBC1D3 siRNA (Human)
CRJ8745-02 30 nmol

TBC1D3 siRNA (Human)

Sign In for Pricing
View Details
LPP Protein Vector (Rat) (pPB-N-His)
PV279795 500 ng

LPP Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
CCDC83 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
15315065 1.0 µg DNA

CCDC83 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Anti-Human MMP-7 Antibody
MBS4158500-01 0.1 mg

Anti-Human MMP-7 Antibody

Sign In for Pricing
View Details