Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Taste receptor type 2 member 110 (Tas2r110)

This Recombinant Mouse Taste receptor type 2 member 110 (Tas2r110) spans the amino acid sequence from region 1-333.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 110, T2R110, mT2r57, STC 9-1

UniProt

Q7M712

Expression Region

1-333

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSQIISTSDIFTFTIILFVELVIGILGNGFIALVNIMDWTKRRSISSADQILTALAITR FLYVWFMIICILLFMLCPHLLTRSEIVTSIGIIWIVNNHFSVWLATCLGVFYFLKIANFS NSLFLYLKWRVKKVVLMIIQVSMIFLILNLLSLSMYDQFSIDVYEGNTSYNLGDSTPFPT ISLFINSSKVFVITNSSHIFLPINSLFMLIPFTVSLVAFLMLIFSLWKHHKKMQVNAKPP RDASTMAHIKALQTGFSFLLLYAVYLLFIVIGMLSLRLIGGKLILLFDHISGIGFPISHS FVLILGNNKLRQASLSVLHCLRCRSKDMDTMGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIN1 Polyclonal Antibody
E-AB-90675-01 60 µL

RIN1 Polyclonal Antibody

Sign In for Pricing
View Details
RIN1 Polyclonal Antibody
E-AB-90675-02 120 µL

RIN1 Polyclonal Antibody

Sign In for Pricing
View Details
RIN1 Polyclonal Antibody
E-AB-90675-03 200 µL

RIN1 Polyclonal Antibody

Sign In for Pricing
View Details
CD117 (KIT/982), CF594 conjugate, 0.1mg/mL
BNC940982-100 1x 100 µL

CD117 (KIT/982), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carboxylated - 96 well Solid plates - Black PS
MCB04F-COOH 10x 96 Well Plates

Carboxylated - 96 well Solid plates - Black PS

Sign In for Pricing
View Details
Epstein-Barr Virus (LMP-1) (CS3), CF647 conjugate, 0.1mg/mL
BNC471743-100 1x 100 µL

Epstein-Barr Virus (LMP-1) (CS3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details