Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Taste receptor type 2 member 110 (Tas2r110)

This Recombinant Mouse Taste receptor type 2 member 110 (Tas2r110) spans the amino acid sequence from region 1-333.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 110, T2R110, mT2r57, STC 9-1

UniProt

Q7M712

Expression Region

1-333

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSQIISTSDIFTFTIILFVELVIGILGNGFIALVNIMDWTKRRSISSADQILTALAITR FLYVWFMIICILLFMLCPHLLTRSEIVTSIGIIWIVNNHFSVWLATCLGVFYFLKIANFS NSLFLYLKWRVKKVVLMIIQVSMIFLILNLLSLSMYDQFSIDVYEGNTSYNLGDSTPFPT ISLFINSSKVFVITNSSHIFLPINSLFMLIPFTVSLVAFLMLIFSLWKHHKKMQVNAKPP RDASTMAHIKALQTGFSFLLLYAVYLLFIVIGMLSLRLIGGKLILLFDHISGIGFPISHS FVLILGNNKLRQASLSVLHCLRCRSKDMDTMGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nlrc3 Pre-designed siRNA Set A
SI109409A 1 Each

Mouse Nlrc3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
GLT11, NT (GALNT11, Polypeptide N-acetylgalactosaminyltransferase 11, Polypeptide GalNAc transferase 11, Protein-UDP acetylgalactosaminyltransferase 11, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 11) (MaxLight 750) discontinued
036098-ML750 100 µL

GLT11, NT (GALNT11, Polypeptide N-acetylgalactosaminyltransferase 11, Polypeptide GalNAc transferase 11, Protein-UDP acetylgalactosaminyltransferase 11, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 11) (MaxLight 750) discontinued

Sign In for Pricing
View Details
RGS12 Protein Vector (Human) (pPB-C-His)
PV115670 500 ng

RGS12 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
MGC26963 Recombinant Protein (Human)
RP019342 100 µg

MGC26963 Recombinant Protein (Human)

Sign In for Pricing
View Details
Deoxyribonuclease II, CT (DNase II, DNaseII, Deoxyribonuclease 2, DNASE2) (MaxLight 490)
MBS6472246-01 0.1 mL

Deoxyribonuclease II, CT (DNase II, DNaseII, Deoxyribonuclease 2, DNASE2) (MaxLight 490)

Sign In for Pricing
View Details
Deoxyribonuclease II, CT (DNase II, DNaseII, Deoxyribonuclease 2, DNASE2) (MaxLight 490)
MBS6472246-02 5x 0.1 mL

Deoxyribonuclease II, CT (DNase II, DNaseII, Deoxyribonuclease 2, DNASE2) (MaxLight 490)

Sign In for Pricing
View Details