Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Probable G-protein coupled receptor 146 (gpr146)

This Recombinant Xenopus laevis Probable G-protein coupled receptor 146 (gpr146) spans the amino acid sequence from region 1-333.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 146

UniProt

Q6P7G9

Expression Region

1-333

Origin

Xenopus laevis (African clawed frog)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWSCEDLNYTNSGEEQYLCNEFHLFLFIFSVLYLIICFPVGLCYNVQLVLVNLYNKATMT MPDVYFVNMAIAGLIINAVAPVYLFGPAYTKWSLWSFGNEVYITLLILFNVSSLVIMYST TLLSLDYYIECALPRTYMSSVYNTKHVCGFIWGGAVLTSFSSLLFYICNHVSTKIIECSK MQNREAADAIMVLIGYVVPIIAVIYALVLILQIRKEATPLDQESGRLDPSVHRLLIATVC TQFILWTPYYVTLLVNTFMDARVKSSNTFYIRIFQFTEGLSNFLAFSSSFVLPLIHRHIN KNFSGKLQRLLKRLHCGSQGCTHEHTVVQQVMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-100 1x 100 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
BNC940017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF640R conjugate, 0.1mg/mL
BNC400039-500 1x 500 µL

CD34 (ICO-115), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
BNC940009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL
BNC401050-100 1x 100 µL

CD3e (CRIS-7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (VCAM1/843), CF640R conjugate, 0.1mg/mL
BNC400843-100 1x 100 µL

CD106 / VCAM1 (VCAM1/843), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details