Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avena sativa Chlorophyll synthase, chloroplastic (CHLG)

This Recombinant Avena sativa Chlorophyll synthase, chloroplastic (CHLG) spans the amino acid sequence from region 46-378.

Product Specifications

Product Name Alternative

Chlorophyll synthase, chloroplastic, EC= 2.5.1.62, Polyprenyl transferase

UniProt

Q9M3W5

Expression Region

46-378

Origin

Avena sativa (Oat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CAADADAKETTKKPTIPDKAPAAGSSFNQLLGIKGAKQETNIWKIRLQLTKPVTWPPLVW GVLCGAAASGNFHWTVEDVTKSIVCMLMSGPCLTGYTQTINDWYDRDIDAINEPYRPIPS GAISENEVITQIWVLLLGGLGLGALLDIWAGHDFPIIFYLALGGSLLSYIYSAPPLKLKQ NGWIGNFALGASYIGLPWWAGQALFGTLTPDIVVLTCLYSIAGLGIAIVNDFKSIEGDRT LGLQSLPVAFGMETAKWICVGAIDITQLSVAAYLLSTGKLYYALALLGLTIPQVILQFQY FLKDPVKYDVKYQASAQPFFVFGLLVTALATSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF571 (NM_001290314) Human Untagged Clone
SC336969 10 µg

ZNF571 (NM_001290314) Human Untagged Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS705932 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
PGR (Progesterone Receptor, NR3C3, PR) (HRP)
MBS6179717-01 0.1 mL

PGR (Progesterone Receptor, NR3C3, PR) (HRP)

Sign In for Pricing
View Details
PGR (Progesterone Receptor, NR3C3, PR) (HRP)
MBS6179717-02 5x 0.1 mL

PGR (Progesterone Receptor, NR3C3, PR) (HRP)

Sign In for Pricing
View Details
Human FHOD3 Protein Lysate
MBS8411779-01 0.02 mg

Human FHOD3 Protein Lysate

Sign In for Pricing
View Details
Human FHOD3 Protein Lysate
MBS8411779-02 5x 0.02 mg

Human FHOD3 Protein Lysate

Sign In for Pricing
View Details