Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-11 (sra-11)

This Recombinant Serpentine receptor class alpha-11 (sra-11) spans the amino acid sequence from region 1-334.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-11, Protein sra-11

UniProt

Q20411

Expression Region

1-334

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTNNPVCASDAHMEMYSSKLYTSALFLNLIIATTSMILTGFAIQKLFMESIINISTRMF LFCGLMCCSLHQTAYIVLRIQVIYQVFFKLSEPCNLYYPAIDCKYVTFSLVAGNTGMIFI QSAMTIDRIFATIFPKLWPKLKYWPGVVLSILMIACNYANVQIIFWGDPLTEYVPTCGQF PSKSVNRFQTFLAIALYMSIAHMVINVIILYINVLQDRQQSKSFNVNQRYQSREALKSSQ AIFFLSMSQFFACLIYSVFTKVFLEFQLNLSPLQSGLVLALSYTTPYACIAIPSLIIFTF RFIKNQRLRNINELRSQTETGDECMRKIAKIWEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
BNC680225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF740 conjugate, 0.1mg/mL
BNC740861-500 1x 500 µL

HSP27 (G3.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF555 conjugate, 0.1mg/mL
BNC551052-500 1x 500 µL

CD3e (B-B12), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF488A conjugate, 0.1mg/mL
BNC881953-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF594 conjugate, 0.1mg/mL
BNC941531-500 1x 500 µL

IL3RA / CD123 (Acute Myeloid Leukemia Marker) (IL3RA/1531), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), Biotin conjugate, 0.1mg/mL
BNCB0633-500 1x 500 µL

Von Willebrand Factor (3E2D10), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details