Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 12 (Gpr12)

This Recombinant Mouse G-protein coupled receptor 12 (Gpr12) spans the amino acid sequence from region 1-334.

Product Specifications

Product Name Alternative

G-protein coupled receptor 12, GPCR01

UniProt

P35412

Expression Region

1-334

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEDPKVNLSGLPRDCIDAGAPENISAAVPSQGSVAESEPELVVNPWDIVLCSSGTLICC ENAVVVLIIFHSPSLRAPMFLLIGSLALADLLAGLGLIINFVFAYLLQSEATKLVTIGLI VASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWN CLRDESTCSVVRPLTKNNAAILSISFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLAT SHYVTTRKGVSTLALILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVI YAFRNQEIQKALCLICCGCIPSSLSQRARSPSDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDss 10 umol scale
26-6566-10 1 Each

DDss 10 umol scale

Sign In for Pricing
View Details
EDG1 (S1PR1) Rabbit Polyclonal Antibody
AP05083PU-N 100 µg

EDG1 (S1PR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mthfd2l (NM_026788) Mouse Tagged Lenti ORF Clone
MR214400L4 10 µg

Mthfd2l (NM_026788) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tob2 (NM_001007146) Rat Tagged Lenti ORF Clone
RR210896L4 10 µg

Tob2 (NM_001007146) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human CYTIP AssayLite™ Antibody (RPE Conjugate)
32517-05151 5x 30 µg

Human CYTIP AssayLite™ Antibody (RPE Conjugate)

Sign In for Pricing
View Details
SNIP Antibody
orb195137-01 50 μL

SNIP Antibody

Sign In for Pricing
View Details