Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G-protein coupled receptor 12 (GPR12)

This Recombinant Human G-protein coupled receptor 12 (GPR12) spans the amino acid sequence from region 1-334.

Product Specifications

Product Name Alternative

G-protein coupled receptor 12

UniProt

P47775

Expression Region

1-334

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCTSGTLISC ENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLI VASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWN CLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLAT SHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVI YAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FE Antibody Pair Set
E-KAB-0027 50 µL & 100 µg

Human FE Antibody Pair Set

Sign In for Pricing
View Details
Recombinant Mouse IL-17C Protein (Sumo Tag)
PDEM100174-01 20 µg

Recombinant Mouse IL-17C Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-17C Protein (Sumo Tag)
PDEM100174-02 100 µg

Recombinant Mouse IL-17C Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-17C Protein (Sumo Tag)
PDEM100174-03 500 µg

Recombinant Mouse IL-17C Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-17C Protein (Sumo Tag)
PDEM100174-04 1 mg

Recombinant Mouse IL-17C Protein (Sumo Tag)

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS501108 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details