Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G-protein coupled receptor 12 (GPR12)

This Recombinant Human G-protein coupled receptor 12 (GPR12) spans the amino acid sequence from region 1-334.

Product Specifications

Product Name Alternative

G-protein coupled receptor 12

UniProt

P47775

Expression Region

1-334

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCTSGTLISC ENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLI VASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWN CLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLAT SHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVI YAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc Sulfate (Solution in Water)
TRC-Z439985-1L 1 L

Zinc Sulfate (Solution in Water)

Sign In for Pricing
View Details
MEF2A pSer408 Rabbit Polyclonal Antibody
AP02539PU-N 100 µL

MEF2A pSer408 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TIMP1 (NM_003254) Human Recombinant Protein
TP723878 10 µg

TIMP1 (NM_003254) Human Recombinant Protein

Sign In for Pricing
View Details
SLC35A2 (NM_001032289) Human Over-expression Lysate
LC422299 20 µg

SLC35A2 (NM_001032289) Human Over-expression Lysate

Sign In for Pricing
View Details
Quercetin 7-O-beta-D-Glucuronide
TRC-Q509515-25MG 25 mg

Quercetin 7-O-beta-D-Glucuronide

Sign In for Pricing
View Details
Recombinant Human CCD5L Protein (His Tag)
PKSH031429 100 µg

Recombinant Human CCD5L Protein (His Tag)

Sign In for Pricing
View Details