Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human G-protein coupled receptor 12 (GPR12)

This Recombinant Human G-protein coupled receptor 12 (GPR12) spans the amino acid sequence from region 1-334.

Product Specifications

Product Name Alternative

G-protein coupled receptor 12

UniProt

P47775

Expression Region

1-334

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIVLCTSGTLISC ENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLITNFVFAYLLQSEATKLVTIGLI VASFSASVCSLLAITVDRYLSLYYALTYHSERTVTFTYVMLVMLWGTSICLGLLPVMGWN CLRDESTCSVVRPLTKNNAAILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLAT SHYVTTRKGVSTLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVI YAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carboxy Polystyrene
H25031508.25G 25 g

Carboxy Polystyrene

Sign In for Pricing
View Details
LIMK2 Recombinant Rabbit monoclonal Antibody
HA751247 100 µL

LIMK2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS708101 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2925), CF740 conjugate, 0.1mg/mL
BNC742925-500 1x 500 µL

Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2925), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CTBP1-DT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C6]
TA503479AM 100 µL

CTBP1-DT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C6]

Sign In for Pricing
View Details
Recombinant Synapsin-2 Antibody
RC-5935-01 50 μL

Recombinant Synapsin-2 Antibody

Sign In for Pricing
View Details