Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-11 (srg-11)

This Recombinant Serpentine receptor class gamma-11 (srg-11) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-11, Protein srg-11

UniProt

P46569

Expression Region

1-335

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSFRPNISNDLDTIIFECNSNYDTIVEVTKWFLQIAYLIPGGILNILLLYTILFKNSEI YASSSFFLIYSTDCFVSFSMIFLDIIGRTLVYFTPLCPIIAPMFYEPLIGFKIMMIVLHH SRACKSLIQILLVVNRMSCVIYPIRYGKMWMRPLKYLIILVFVIPFSIDWNLIISRVYMQ PTFGGIYMEYIKKVAWASQSRFQLIFITIALLFTIVCTSVIFYTLVMLPKRLRNVERTLS LGTAYISMSFIILVVFQFLFAFYSDIFTTSTIFGYSLLSYDILNVGSPIIMHCVSSKLRN HVLRGSRKLSSAARVVPVSNVTSTNGWVNLIVITL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMIM15 (NM_001048249) Human Recombinant Protein
TP323910L 1 mg

SMIM15 (NM_001048249) Human Recombinant Protein

Sign In for Pricing
View Details
Factor VII (F7) Human Gene Knockout Kit (CRISPR)
KN213143 1 Kit

Factor VII (F7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chitosan Oligosaccharide Hydrochloride Salt (Technical Grade)
TRC-C315018-50G 50 g

Chitosan Oligosaccharide Hydrochloride Salt (Technical Grade)

Sign In for Pricing
View Details
KAT3A / CBP (CREBBP) Rabbit Polyclonal Antibody
AP06074PU-N 100 µg

KAT3A / CBP (CREBBP) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Quinaldine Red
TRC-Q585003-1G 1 g

Quinaldine Red

Sign In for Pricing
View Details
Frozen Tissue Sections, Seminal vesicle
CS500896 5x 5 µm

Frozen Tissue Sections, Seminal vesicle

Sign In for Pricing
View Details