Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-11 (srg-11)

This Recombinant Serpentine receptor class gamma-11 (srg-11) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-11, Protein srg-11

UniProt

P46569

Expression Region

1-335

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSFRPNISNDLDTIIFECNSNYDTIVEVTKWFLQIAYLIPGGILNILLLYTILFKNSEI YASSSFFLIYSTDCFVSFSMIFLDIIGRTLVYFTPLCPIIAPMFYEPLIGFKIMMIVLHH SRACKSLIQILLVVNRMSCVIYPIRYGKMWMRPLKYLIILVFVIPFSIDWNLIISRVYMQ PTFGGIYMEYIKKVAWASQSRFQLIFITIALLFTIVCTSVIFYTLVMLPKRLRNVERTLS LGTAYISMSFIILVVFQFLFAFYSDIFTTSTIFGYSLLSYDILNVGSPIIMHCVSSKLRN HVLRGSRKLSSAARVVPVSNVTSTNGWVNLIVITL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C16orf42 (TSR3) (NM_001001410) Human Over-expression Lysate
LY424339 100 µg

C16orf42 (TSR3) (NM_001001410) Human Over-expression Lysate

Sign In for Pricing
View Details
DDX58 Recombinant Rabbit Monoclonal Antibody [JE60-05]
HA720090 100 µL

DDX58 Recombinant Rabbit Monoclonal Antibody [JE60-05]

Sign In for Pricing
View Details
Texas Red Conjugated Rabbit Affinity Purified Antibody to Goat IgG, Fc Specific
TAF-521-1 1 mL

Texas Red Conjugated Rabbit Affinity Purified Antibody to Goat IgG, Fc Specific

Sign In for Pricing
View Details
Neurofilament (H+L) (NF421 + NFL736), CF405S conjugate, 0.1mg/mL
BNC040756-100 1x 100 µL

Neurofilament (H+L) (NF421 + NFL736), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aluminum Oxide (Activated, Basic, Brockmann I)
TRC-A575717-250G 250 g

Aluminum Oxide (Activated, Basic, Brockmann I)

Sign In for Pricing
View Details
Ficlatuzumab Biosimilar - Research Grade
ICH5153-50mg 50 mg

Ficlatuzumab Biosimilar - Research Grade

Sign In for Pricing
View Details