Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-13 (sra-13)

This Recombinant Serpentine receptor class alpha-13 (sra-13) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-13, Protein sra-13

UniProt

Q20618

Expression Region

1-335

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAIISSVNRTCASESLLELYRSYKYILSTSFNIIIPIISLFFLVYAIKQLCAQSIIQYST RVLLITTILFAVCHQIAYFCFKADLLYTMLFKLDQPCNLQHSSYDCRFITIATTTSNCGM ALVQLAMSIDRVFALKFNRVYYKLKSIPGITLALITLSISFSMFFILTIDDPLSGYVNHC GFYPTYSQDKFHIFLDVTLYLAVFNFVFDIGLMYYSYQEILWKRSYSFVNRFQSRISLKC TQAIFIISICQCISNVLYSGLLSLLMKLGRYMSSADYNLSLSLAYTTPYSCLILPILICK VLEYIKKQRTVGILSLRNQKQSMEGHMAMINSAWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mapk13 (NM_011950) Mouse Recombinant Protein
TP505630 20 µg

Mapk13 (NM_011950) Mouse Recombinant Protein

Sign In for Pricing
View Details
RP11-529I10.4, ID (DPCD, Protein DPCD) (Biotin)
MBS6343151-01 0.2 mL

RP11-529I10.4, ID (DPCD, Protein DPCD) (Biotin)

Sign In for Pricing
View Details
RP11-529I10.4, ID (DPCD, Protein DPCD) (Biotin)
MBS6343151-02 5x 0.2 mL

RP11-529I10.4, ID (DPCD, Protein DPCD) (Biotin)

Sign In for Pricing
View Details
Factor XIII Matched ELISA Antibody Pair Set, Human
MBS8118376-01 5 Plates

Factor XIII Matched ELISA Antibody Pair Set, Human

Sign In for Pricing
View Details
Factor XIII Matched ELISA Antibody Pair Set, Human
MBS8118376-02 15 Plates

Factor XIII Matched ELISA Antibody Pair Set, Human

Sign In for Pricing
View Details
Factor XIII Matched ELISA Antibody Pair Set, Human
MBS8118376-03 5x 15 Plates

Factor XIII Matched ELISA Antibody Pair Set, Human

Sign In for Pricing
View Details