Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-13 (sra-13)

This Recombinant Serpentine receptor class alpha-13 (sra-13) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-13, Protein sra-13

UniProt

Q20618

Expression Region

1-335

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAIISSVNRTCASESLLELYRSYKYILSTSFNIIIPIISLFFLVYAIKQLCAQSIIQYST RVLLITTILFAVCHQIAYFCFKADLLYTMLFKLDQPCNLQHSSYDCRFITIATTTSNCGM ALVQLAMSIDRVFALKFNRVYYKLKSIPGITLALITLSISFSMFFILTIDDPLSGYVNHC GFYPTYSQDKFHIFLDVTLYLAVFNFVFDIGLMYYSYQEILWKRSYSFVNRFQSRISLKC TQAIFIISICQCISNVLYSGLLSLLMKLGRYMSSADYNLSLSLAYTTPYSCLILPILICK VLEYIKKQRTVGILSLRNQKQSMEGHMAMINSAWK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-E3 SUMO-protein ligase PIAS2 PIAS2 Antibody
A04130 0.1 mg

Anti-E3 SUMO-protein ligase PIAS2 PIAS2 Antibody

Sign In for Pricing
View Details
ZNF517 sgRNA CRISPR Lentivector (Human) (Target 1)
K2711502 1.0 µg DNA

ZNF517 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Mouse Monoclonal USP7 Antibody (OTI1F12) [PE/Atto594]
NBP2-74814PEATT594 0.1 mL

Mouse Monoclonal USP7 Antibody (OTI1F12) [PE/Atto594]

Sign In for Pricing
View Details
NSMCE2 Antibody - middle region
ARP55690_P050-25UL 25 µL

NSMCE2 Antibody - middle region

Sign In for Pricing
View Details
HLA-C Antibody
orb401644-01 50 µg

HLA-C Antibody

Sign In for Pricing
View Details
HLA-C Antibody
orb401644-02 100 µg

HLA-C Antibody

Sign In for Pricing
View Details