Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Cholinephosphotransferase 1 (CHPT1)

This Recombinant Chicken Cholinephosphotransferase 1 (CHPT1) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Cholinephosphotransferase 1, EC= 2.7.8.2, Diacylglycerol cholinephosphotransferase 1

UniProt

Q5ZHQ5

Expression Region

1-335

Origin

Gallus gallus (Chicken)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAPWVLPAPLSPAQLKRLEQHRYSSAGRSLLEPWLQPYWGWLVERLPPWLAPNAITLGG LLLNCLTALPLIASCPTATEQAPFWAYILGALGLFIYQSLDAIDGKQARRTNSSSPLGEL FDHGCDSISTVFVVLGSCIAIRLGTNPDWLFFCCFVGLFMFYSAHWQTYVSGILRFGKVD VTEVQIAITMLLLVSAFCGTAVWDYKVHLVGLELKFFAVVGILCGTAVSCFNYFRIIFGG GVGKNGSTIAVAHMTKSEISLQDTAFIGPGLLFLDQYFNSFIDEYVVLWIALFISLFDML RYATGVCLQIAAHLHIHVFRISSHQAPEQVQNHND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Crossover junction endonuclease EME1 (EME1) ELISA Kit
GTR10345908 96 Well

Sheep Crossover junction endonuclease EME1 (EME1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Shigella Sonnei secM Protein (aa 38-170)
VAng-0183Lsx-50gEcoli 50 µg (E. coli)

Recombinant Shigella Sonnei secM Protein (aa 38-170)

Sign In for Pricing
View Details
TRNAA39 3'UTR GFP Stable Cell Line
TU076668 1.0 mL

TRNAA39 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Dibutyl acid pyrophosphate
D11095-01 25 g

Dibutyl acid pyrophosphate

Sign In for Pricing
View Details
Dibutyl acid pyrophosphate
D11095-02 100 g

Dibutyl acid pyrophosphate

Sign In for Pricing
View Details
MAGEA9 (Melanoma Antigen Family A 9, MAGE-9 Antigen, OTTHUMP00000024214, MAGE9, MGC8421, Melanoma-Associated Antigen 9) (MaxLight 550)
207768-ML550 100 µL

MAGEA9 (Melanoma Antigen Family A 9, MAGE-9 Antigen, OTTHUMP00000024214, MAGE9, MGC8421, Melanoma-Associated Antigen 9) (MaxLight 550)

Sign In for Pricing
View Details