Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Cholinephosphotransferase 1 (CHPT1)

This Recombinant Chicken Cholinephosphotransferase 1 (CHPT1) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Cholinephosphotransferase 1, EC= 2.7.8.2, Diacylglycerol cholinephosphotransferase 1

UniProt

Q5ZHQ5

Expression Region

1-335

Origin

Gallus gallus (Chicken)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAPWVLPAPLSPAQLKRLEQHRYSSAGRSLLEPWLQPYWGWLVERLPPWLAPNAITLGG LLLNCLTALPLIASCPTATEQAPFWAYILGALGLFIYQSLDAIDGKQARRTNSSSPLGEL FDHGCDSISTVFVVLGSCIAIRLGTNPDWLFFCCFVGLFMFYSAHWQTYVSGILRFGKVD VTEVQIAITMLLLVSAFCGTAVWDYKVHLVGLELKFFAVVGILCGTAVSCFNYFRIIFGG GVGKNGSTIAVAHMTKSEISLQDTAFIGPGLLFLDQYFNSFIDEYVVLWIALFISLFDML RYATGVCLQIAAHLHIHVFRISSHQAPEQVQNHND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Coagulation factor XIII A chain, F13A1 ELISA KIT
ELI-02359b 96 Tests

Bovine Coagulation factor XIII A chain, F13A1 ELISA KIT

Sign In for Pricing
View Details
Lentiviral mouse Vps39 shRNA (UAS) - Lentiviral mouse Vps39 shRNA (UAS, RFP) (100)
GTR15300723 1 Vial

Lentiviral mouse Vps39 shRNA (UAS) - Lentiviral mouse Vps39 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
EPB41L3 Antibody - N-terminal region
ARP73951_P050-25UL 25 µL

EPB41L3 Antibody - N-terminal region

Sign In for Pricing
View Details
Lentiviral human PIGC shRNA (UAS) - Lentiviral human PIGC shRNA (UAS, iRFP) plasmid
GTR15314083 1 Vial

Lentiviral human PIGC shRNA (UAS) - Lentiviral human PIGC shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
ErbB 4 Rabbit pAb
APA4905-01 30 µL

ErbB 4 Rabbit pAb

Sign In for Pricing
View Details
ErbB 4 Rabbit pAb
APA4905-02 50 μL

ErbB 4 Rabbit pAb

Sign In for Pricing
View Details