Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Cholinephosphotransferase 1 (CHPT1)

This Recombinant Chicken Cholinephosphotransferase 1 (CHPT1) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Cholinephosphotransferase 1, EC= 2.7.8.2, Diacylglycerol cholinephosphotransferase 1

UniProt

Q5ZHQ5

Expression Region

1-335

Origin

Gallus gallus (Chicken)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAPWVLPAPLSPAQLKRLEQHRYSSAGRSLLEPWLQPYWGWLVERLPPWLAPNAITLGG LLLNCLTALPLIASCPTATEQAPFWAYILGALGLFIYQSLDAIDGKQARRTNSSSPLGEL FDHGCDSISTVFVVLGSCIAIRLGTNPDWLFFCCFVGLFMFYSAHWQTYVSGILRFGKVD VTEVQIAITMLLLVSAFCGTAVWDYKVHLVGLELKFFAVVGILCGTAVSCFNYFRIIFGG GVGKNGSTIAVAHMTKSEISLQDTAFIGPGLLFLDQYFNSFIDEYVVLWIALFISLFDML RYATGVCLQIAAHLHIHVFRISSHQAPEQVQNHND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FUNDC1 Polyclonal Antibody
TMAB-00720-01 50 μL

Anti-FUNDC1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-FUNDC1 Polyclonal Antibody
TMAB-00720-02 100 µL

Anti-FUNDC1 Polyclonal Antibody

Sign In for Pricing
View Details
Drosophila melanogaster Anp32a Rabbit Polyclonal Antibody (Fluoro550)
orb3086578 200 µL

Drosophila melanogaster Anp32a Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
CBARA1 Rabbit Polyclonal Antibody
orb513193 100 µg

CBARA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Th-POK (T-helper-inducing POZ/Krueppel-like factor, Zinc Finger protein 67 Homolog, ZFP67, Zinc Finger and BTB Domain-containing Protein 7B, ZBTB7B) discontinued
045331 100 µg

Th-POK (T-helper-inducing POZ/Krueppel-like factor, Zinc Finger protein 67 Homolog, ZFP67, Zinc Finger and BTB Domain-containing Protein 7B, ZBTB7B) discontinued

Sign In for Pricing
View Details
Anti-Profilin 2/PFN2 Antibody Picoband®, PE Conjugate
A06663-PE 100 µg/Vial

Anti-Profilin 2/PFN2 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details