Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glucose-dependent insulinotropic receptor (Gpr119)

This Recombinant Mouse Glucose-dependent insulinotropic receptor (Gpr119) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Glucose-dependent insulinotropic receptor, G-protein coupled receptor 119

UniProt

Q7TQP3

Expression Region

1-335

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESSFSFGVILAVLTILIIAVNALVVVAMLLSIYKNDGVGLCFTLNLAVADTLIGVAISG LVTDQLSSSAQHTQKTLCSLRMAFVTSSAAASVLTVMLIAFDRYLAIKQPLRYFQIMNGL VAGACIAGLWLVSYLIGFLPLGVSIFQQTTYHGPCSFFAVFHPRFVLTLSCAGFFPAVLL FVFFYCDMLKIASVHSQQIRKMEHAGAMAGAYRPPRSVNDFKAVRTIAVLIGSFTLSWSP FLITSIVQVACHKCCLYQVLEKYLWLLGVGNSLLNPLIYAYWQREVRQQLYHMALGVKKF FTSILLLLPARNRGPERTRESAYHIVTISHPELDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNISR Human Gene Knockout Kit (CRISPR)
KN413713 1 Kit

PNISR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Chromogranin A (CHGA/413), CF488A conjugate, 0.1mg/mL
BNC880413-500 1x 500 µL

Chromogranin A (CHGA/413), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS505317 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Cytokeratin, multi (C11), CF740 conjugate, 0.1mg/mL
BNC740393-500 1x 500 µL

Cytokeratin, multi (C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAP3K5 Antibody
KC-1340-01 50 μL

MAP3K5 Antibody

Sign In for Pricing
View Details
MAP3K5 Antibody
KC-1340-02 100 µL

MAP3K5 Antibody

Sign In for Pricing
View Details