Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glucose-dependent insulinotropic receptor (Gpr119)

This Recombinant Mouse Glucose-dependent insulinotropic receptor (Gpr119) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Glucose-dependent insulinotropic receptor, G-protein coupled receptor 119

UniProt

Q7TQP3

Expression Region

1-335

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESSFSFGVILAVLTILIIAVNALVVVAMLLSIYKNDGVGLCFTLNLAVADTLIGVAISG LVTDQLSSSAQHTQKTLCSLRMAFVTSSAAASVLTVMLIAFDRYLAIKQPLRYFQIMNGL VAGACIAGLWLVSYLIGFLPLGVSIFQQTTYHGPCSFFAVFHPRFVLTLSCAGFFPAVLL FVFFYCDMLKIASVHSQQIRKMEHAGAMAGAYRPPRSVNDFKAVRTIAVLIGSFTLSWSP FLITSIVQVACHKCCLYQVLEKYLWLLGVGNSLLNPLIYAYWQREVRQQLYHMALGVKKF FTSILLLLPARNRGPERTRESAYHIVTISHPELDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHARP1 (BHLHE41) Mouse Monoclonal Antibody [Clone ID: OTI8A8]
CF806509 100 µg

SHARP1 (BHLHE41) Mouse Monoclonal Antibody [Clone ID: OTI8A8]

Sign In for Pricing
View Details
SPDYA (NM_001142634) Human Over-expression Lysate
LC428224 20 µg

SPDYA (NM_001142634) Human Over-expression Lysate

Sign In for Pricing
View Details
ADO (NM_032804) Human Recombinant Protein
TP305583L 1 mg

ADO (NM_032804) Human Recombinant Protein

Sign In for Pricing
View Details
Human FYTTD1 activation kit by CRISPRa
GA113447 1 Kit

Human FYTTD1 activation kit by CRISPRa

Sign In for Pricing
View Details
VDAC1 Rabbit Polyclonal Antibody
TA383209 100 µL

VDAC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant ITGA2B Antibody
RC-4254-01 50 μL

Recombinant ITGA2B Antibody

Sign In for Pricing
View Details