Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2AK2 (OR2AK2)

This Recombinant Human Olfactory receptor 2AK2 (OR2AK2) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Olfactory receptor 2AK2, Olfactory receptor 2AK1, Olfactory receptor OR1-47

UniProt

Q8NG84

Expression Region

1-335

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNISDVISFDILVSAMKTGNQSFGTDFLLVGLFQYGWINSLLFVVIATLFTVALTGNIML IHLIRLNTRLHTPMYFLLSQLSIVDLMYISTTVPKMAVSFLSQSKTIRFLGCEIQTYVFL ALGGTEALLLGFMSYDRYVAICHPLHYPMLMSKKICCLMVACAWASGSINAFIHTLYVFQ LPFCRSRLINHFFCEVPALLSLVCQDTSQYEYTVLLSGLIILLLPFLAILASYARVLIVV FQMSSGKGQAKAVSTCSSHLIVASLFYATTLFTYTRPHSLRSPSRDKAVAVFYTIVTPLL NPFIYSLRNKEVTGAVRRLLGYWICCRKYDFRSLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monofunctional C1-tetrahydrofolate synthase, mitochondrial (MTHFD1L) ELISA Kit
EIA06799m 1 Kit

Mouse Monofunctional C1-tetrahydrofolate synthase, mitochondrial (MTHFD1L) ELISA Kit

Sign In for Pricing
View Details
UBE2J1 Rabbit Polyclonal Antibody (Cy5)
orb879230 100 µL

UBE2J1 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
RPS19 Antibody
CSB-PA00655A0Rb-01 50 µg

RPS19 Antibody

Sign In for Pricing
View Details
RPS19 Antibody
CSB-PA00655A0Rb-02 100 µg

RPS19 Antibody

Sign In for Pricing
View Details
TLE3 Protein Vector (Rat) (pPM-C-His)
PV310981 500 ng

TLE3 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
RNU7-65P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1861005 3x 1.0 µg

RNU7-65P sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details