Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2AK2 (OR2AK2)

This Recombinant Human Olfactory receptor 2AK2 (OR2AK2) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Olfactory receptor 2AK2, Olfactory receptor 2AK1, Olfactory receptor OR1-47

UniProt

Q8NG84

Expression Region

1-335

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNISDVISFDILVSAMKTGNQSFGTDFLLVGLFQYGWINSLLFVVIATLFTVALTGNIML IHLIRLNTRLHTPMYFLLSQLSIVDLMYISTTVPKMAVSFLSQSKTIRFLGCEIQTYVFL ALGGTEALLLGFMSYDRYVAICHPLHYPMLMSKKICCLMVACAWASGSINAFIHTLYVFQ LPFCRSRLINHFFCEVPALLSLVCQDTSQYEYTVLLSGLIILLLPFLAILASYARVLIVV FQMSSGKGQAKAVSTCSSHLIVASLFYATTLFTYTRPHSLRSPSRDKAVAVFYTIVTPLL NPFIYSLRNKEVTGAVRRLLGYWICCRKYDFRSLY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLX5 Human qPCR Primer Pair (NM_005221)
HP208397 200 Reactions

DLX5 Human qPCR Primer Pair (NM_005221)

Sign In for Pricing
View Details
mmu-mir-140* RT-PCR Detection and U6 Calibration Kit
abx096676-01 50 Reactions

mmu-mir-140* RT-PCR Detection and U6 Calibration Kit

Sign In for Pricing
View Details
mmu-mir-140* RT-PCR Detection and U6 Calibration Kit
abx096676-02 100 Reactions

mmu-mir-140* RT-PCR Detection and U6 Calibration Kit

Sign In for Pricing
View Details
mmu-mir-140* RT-PCR Detection and U6 Calibration Kit
abx096676-03 200 Reactions

mmu-mir-140* RT-PCR Detection and U6 Calibration Kit

Sign In for Pricing
View Details
PECI (32)
sc-136374 200 µg/mL

PECI (32)

Sign In for Pricing
View Details
Myot sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6698805 3x 1.0 µg

Myot sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details