Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 52B6 (OR52B6)

This Recombinant Human Olfactory receptor 52B6 (OR52B6) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Olfactory receptor 52B6, Olfactory receptor OR11-47

UniProt

Q8NGF0

Expression Region

1-335

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQVRALHKIMALFSANSIGAMNNSDTRIAGCFLTGIPGLEQLHIWLSIPFCIMYITALE GNGILICVILSQAILHEPMYIFLSMLASADVLLSTTTMPKALANLWLGYSLISFDGCLTQ MFFIHFLFIHSAVLLAMAFDRYVAICSPLRYVTILTSKVIGKIVTAALSHSFIIMFPSIF LLEHLHYCQINIIAHTFCEHMGIAHLSCSDISINVWYGLAAALLSTGLDIMLITVSYIHI LQAVFRLLSQDARSKALSTCGSHICVILLFYVPALFSVFAYRFGGRSVPCYVHILLASLY VVIPPMLNPVIYGVRTKPILEGAKQMFSNLAKGSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human EIF1AX Protein, N-His
orb3150704-01 50 µg

Recombinant Human EIF1AX Protein, N-His

Sign In for Pricing
View Details
Recombinant Human EIF1AX Protein, N-His
orb3150704-02 100 µg

Recombinant Human EIF1AX Protein, N-His

Sign In for Pricing
View Details
Recombinant Human EIF1AX Protein, N-His
orb3150704-03 1 mg

Recombinant Human EIF1AX Protein, N-His

Sign In for Pricing
View Details
Lentiviral mouse Cpvl shRNA (UAS) - Lentiviral mouse Cpvl shRNA (UAS, RFP) (25)
GTR15226871 1 Vial

Lentiviral mouse Cpvl shRNA (UAS) - Lentiviral mouse Cpvl shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
TMEM147 Rabbit Polyclonal Antibody (Cy5.5)
orb1037127 100 µL

TMEM147 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
RNASE10 siRNA (Mouse)
MBS8231565-01 15 nmol

RNASE10 siRNA (Mouse)

Sign In for Pricing
View Details